HORDB

ID: hor005504
Uniprot ID: P55845
Protein name: Crustacean hyperglycemic hormone
Gene name: NA
Organism: Procambarus bouvieri (Mexican crayfish)
Family: arthropod CHH/MIH/GIH/VIH hormone family
Source: animal
Expression: Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released.
Disease: NA
Comments: NA
Taxonomy: Procambarus (genus), Cambarinae (subfamily), Cambaridae (family), Astacoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: QVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVVDEYISGVQTV
Length: 72
Propeptide: QVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVVDEYISGVQTV
Signal peptide: NA
Modification: T1 Pyrrolidone carboxylic acid;T3 D-phenylalanine;T72 Valine amide
Glycosylation: NA
Mutagenesis: NA

Function: Control the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-P55845-F1.pdb

hor005504_AF2.pdb

hor005504_ESM.pdb

Mass:	967729	Formula:	C371H579N99O112S6
Absent amino acids:	HMW	Common amino acids:	DV
pI:	4.92	Basic residues:	9
Polar residues:	22	Hydrophobic residues:	25
Hydrophobicity:	-13.89	Boman Index:	-13589
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	91.94
Instability Index:	1913.33	Extinction Coefficient cystines:	9315
Absorbance 280nm:	131.2

PubMed ID: 8441709
Title: Primary structure of the major isomorph of the crustacean hyperglycemic hormone (CHH-I) from the sinus gland of the Mexican crayfish Procambarus bouvieri (Ortmann): interspecies comparison.
PubMed ID: 8745046
Title: Amino acid sequence of the minor isomorph of the crustacean hyperglycemic hormone (CHH-II) of the Mexican crayfish Procambarus bouvieri (Ortmann): presence of a D-amino acid.